What is the amino acid sequence of cagrilintide?
Cagrilintide is a research peptide whose amino acid sequence is on the public registry record. The published sequence is XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP (PubChem line notation; X = non-standard N-terminal unit). Its molecular formula is C194H312N54O59S2. Its molecular weight is 4409.0 g/mol. The CAS Registry Number is 1415456-99-3.
Sequence. XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP (PubChem line notation; X = non-standard N-terminal unit)
Class. peptide (lipidated).
Formula. C194H312N54O59S2.
Mass. 4409.0 g/mol.
Analytical note. Identity confirmation by mass spectrometry uses the mass calculated from the formula. Sable's release specification is ≥99% by HPLC with identity confirmed against the expected mass (quality page). Research use only. Not a medicine. Not for human or veterinary use.
Sources
- https://pubchem.ncbi.nlm.nih.gov/rest/pug_view/data/compound/171397054/JSON?heading=Biologic%20Line%20Notation
- https://pubchem.ncbi.nlm.nih.gov/compound/171397054
Cagrilintide: reference facts
7 Cagrilintide values, each linked to its public source; see the Cagrilintide reference page.
| Synonyms | long-acting acylated amylin analogue (pubchem.ncbi.nlm.nih.gov) |
|---|---|
| Compound class | peptide (lipidated) (pubchem.ncbi.nlm.nih.gov) |
| CAS Registry Number | 1415456-99-3 (pubchem.ncbi.nlm.nih.gov) |
| Molecular formula | C194H312N54O59S2 (pubchem.ncbi.nlm.nih.gov) |
| Molecular weight | 4409.0 g/mol (pubchem.ncbi.nlm.nih.gov) |
| PubChem CID | 171397054 (pubchem.ncbi.nlm.nih.gov) |
| Storage (lyophilised) | -20 °C, dry, protected from light (sigmaaldrich.com) |
Sizes and prices at Sable
| Vial | Price | Per mg | UK same-size check (2026-10-16) |
|---|---|---|---|
| 2 mg | £25.99 | £13.00 | no same-size match |
| 5 mg | £28.98 | £5.80 | lowest other £29.00 across 1 UK sellers |
| 10 mg | £43.99 | £4.40 | lowest other £65.00 across 2 UK sellers |
Multi-vial pricing on the same item: 3+ vials 10% off, 5+ vials 15% off, 10+ vials 20% off. Every lot has a certificate of analysis: CoA library.
Typical analytical method
| HPLC column | C18 reversed-phase (300 A pore, C4/C8 suitable for large/lipidated) |
|---|---|
| Mobile phase | A: water + 0.1% TFA; B: acetonitrile + 0.1% TFA; linear gradient (e.g. 5-65% B over 20-30 min) |
| Detection | 214-220 nm (peptide bond) |
General literature method. The lot CoA records the method actually used. How to read an HPLC chromatogram.
Related questions
Lyophilised storage on file: Cagrilintide
From the Sable storage reference (lyophilised material only; temperature, light, moisture). Literature basis is linked per row. See peptide storage.
| Compound | Lyophilised storage | Light / notes |
|---|---|---|
| Cagrilintide | -20 C long term (-80 C acceptable), sealed and desiccated; 2-8 C for weeks | protect from light; contains Met/Cys/Trp: oxidation-prone; minimise air/headspace exposure (source) |
Typical analytical method: Cagrilintide
Reference HPLC and MS conditions from the Sable analytical-methods file; a lot's CoA states the method actually used. See how to read a CoA.
| Compound | HPLC column / detection | MS / expected ion |
|---|---|---|
| Cagrilintide | C18 reversed-phase (300 A pore, C4/C8 suitable for large/lipidated); 214-220 nm (peptide bond) | ESI-MS (positive mode); LC-MS for identity; [M+3H]3+ ~1470.7; [M+4H]4+ ~1103.3; [M+5H]5+ ~882.8; [M+6H]6+ ~735.8 |
Research use only. Not a medicine. Not for human or veterinary use.