What is the amino acid sequence of tesamorelin?
Tesamorelin is a research peptide whose amino acid sequence is on the public registry record. The published sequence is YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (GHRH 1-44 backbone; N-terminal trans-3-hexenoyl group not shown). Its molecular formula is C221H366N72O67S. Its molecular weight is 5136.0 g/mol. The CAS Registry Number is 218949-48-5.
Sequence. YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (GHRH 1-44 backbone; N-terminal trans-3-hexenoyl group not shown)
Class. peptide.
Formula. C221H366N72O67S.
Mass. 5136.0 g/mol.
Analytical note. Identity confirmation by mass spectrometry uses the mass calculated from the formula. Sable's release specification is ≥99% by HPLC with identity confirmed against the expected mass (quality page). Research use only. Not a medicine. Not for human or veterinary use.
Sources
- https://pubchem.ncbi.nlm.nih.gov/rest/pug_view/data/compound/16137828/JSON?heading=Biologic%20Line%20Notation
- https://pubchem.ncbi.nlm.nih.gov/compound/16137828
Tesamorelin: reference facts
7 Tesamorelin values, each linked to its public source; see the Tesamorelin reference page.
| Synonyms | TH9507; trans-3-hexenoyl-GHRH(1-44)NH2 (pubchem.ncbi.nlm.nih.gov) |
|---|---|
| Compound class | peptide (pubchem.ncbi.nlm.nih.gov) |
| CAS Registry Number | 218949-48-5 (pubchem.ncbi.nlm.nih.gov) |
| Molecular formula | C221H366N72O67S (pubchem.ncbi.nlm.nih.gov) |
| Molecular weight | 5136.0 g/mol (pubchem.ncbi.nlm.nih.gov) |
| PubChem CID | 16137828 (pubchem.ncbi.nlm.nih.gov) |
| Storage (lyophilised) | -20 °C, dry, protected from light (sigmaaldrich.com) |
Sizes and prices at Sable
| Vial | Price | Per mg | UK same-size check (2026-10-16) |
|---|---|---|---|
| 2 mg | £19.93 | £9.97 | lowest other £19.95 across 3 UK sellers |
| 5 mg | £24.97 | £4.99 | lowest other £24.99 across 8 UK sellers |
| 10 mg | £27.93 | £2.79 | lowest other £27.95 across 14 UK sellers |
| 20 mg | £74.98 | £3.75 | lowest other £75.00 across 4 UK sellers |
Multi-vial pricing on the same item: 3+ vials 10% off, 5+ vials 15% off, 10+ vials 20% off. Every lot has a certificate of analysis: CoA library.
Typical analytical method
| HPLC column | C18 reversed-phase (300 A pore, C4/C8 suitable for large/lipidated) |
|---|---|
| Mobile phase | A: water + 0.1% TFA; B: acetonitrile + 0.1% TFA; linear gradient (e.g. 5-65% B over 20-30 min) |
| Detection | 214-220 nm (peptide bond) and 280 nm (Trp/Tyr present) |
General literature method. The lot CoA records the method actually used. How to read an HPLC chromatogram.
Related questions
Lyophilised storage on file
From the Sable storage reference (lyophilised material only; temperature, light, moisture). Literature basis is linked per row. See peptide storage.
| Compound | Lyophilised storage | Light / notes |
|---|---|---|
| Tesamorelin | -20 C long term (-80 C acceptable), sealed and desiccated; 2-8 C for weeks | protect from light; contains Met/Cys/Trp: oxidation-prone; minimise air/headspace exposure (source) |
| Tesamorelin + Ipamorelin | -20 C long term (-80 C acceptable), sealed and desiccated; 2-8 C for weeks | protect from light; multi-component: apply the most restrictive condition of the components (source) |
Typical analytical method: Tesamorelin
Reference HPLC and MS conditions from the Sable analytical-methods file; a lot's CoA states the method actually used. See how to read a CoA.
| Compound | HPLC column / detection | MS / expected ion |
|---|---|---|
| Tesamorelin | C18 reversed-phase (300 A pore, C4/C8 suitable for large/lipidated); 214-220 nm (peptide bond) and 280 nm (Trp/Tyr present) | ESI-MS (positive mode); LC-MS for identity; [M+3H]3+ ~1713.0; [M+4H]4+ ~1285.0; [M+5H]5+ ~1028.2; [M+6H]6+ ~857.0 |
Research use only. Not a medicine. Not for human or veterinary use.