What is the amino acid sequence of sermorelin?
Sermorelin is a research peptide whose amino acid sequence is on the public registry record. The published sequence is YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2. Its molecular formula is C149H246N44O42S. Its molecular weight is 3357.9 g/mol. The CAS Registry Number is 86168-78-7. PubChem CID 16132413 indexes the structure.
Sequence. YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Class. peptide.
Formula. C149H246N44O42S.
Mass. 3357.9 g/mol.
Analytical note. Identity confirmation by mass spectrometry uses the mass calculated from the formula. Sable's release specification is ≥99% by HPLC with identity confirmed against the expected mass (quality page). Research use only. Not a medicine. Not for human or veterinary use.
Sources
Sermorelin: reference facts
8 Sermorelin values, each linked to its public source; see the Sermorelin reference page.
| Synonyms | GRF(1-29)NH2; GHRH (1-29) (pubchem.ncbi.nlm.nih.gov) |
|---|---|
| Compound class | peptide (pubchem.ncbi.nlm.nih.gov) |
| CAS Registry Number | 86168-78-7 (pubchem.ncbi.nlm.nih.gov) |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (pubchem.ncbi.nlm.nih.gov) |
| Molecular formula | C149H246N44O42S (pubchem.ncbi.nlm.nih.gov) |
| Molecular weight | 3357.9 g/mol (pubchem.ncbi.nlm.nih.gov) |
| PubChem CID | 16132413 (pubchem.ncbi.nlm.nih.gov) |
| Storage (lyophilised) | -20 °C, dry, protected from light (sigmaaldrich.com) |
Calculated sequence properties
Computed from the listed sequence. See the methodology.
| Length | 29 residues |
|---|---|
| Theoretical pI | 10.95 (calculated from sequence) |
| Net charge at pH 7 | 3.98 (calculated) |
| Extinction coefficient, 280 nm | 2980 M⁻¹cm⁻¹ (calculated) |
Sizes and prices at Sable
| Vial | Price | Per mg | UK same-size check (2026-10-16) |
|---|---|---|---|
| 2 mg | £12.93 | £6.47 | lowest other £13.95 across 2 UK sellers |
| 5 mg | £22.48 | £4.50 | lowest other £22.50 across 4 UK sellers |
| 10 mg | £30.49 | £3.05 | lowest other £64.99 across 1 UK sellers |
Multi-vial pricing on the same item: 3+ vials 10% off, 5+ vials 15% off, 10+ vials 20% off. Every lot has a certificate of analysis: CoA library.
Typical analytical method
| HPLC column | C18 reversed-phase (100-120 A pore) |
|---|---|
| Mobile phase | A: water + 0.1% TFA; B: acetonitrile + 0.1% TFA; linear gradient (e.g. 5-65% B over 20-30 min) |
| Detection | 214-220 nm (peptide bond) and 280 nm (Trp/Tyr present) |
General literature method. The lot CoA records the method actually used. How to read an HPLC chromatogram.
Related questions
Lyophilised storage on file: Sermorelin
From the Sable storage reference (lyophilised material only; temperature, light, moisture). Literature basis is linked per row. See peptide storage.
| Compound | Lyophilised storage | Light / notes |
|---|---|---|
| Sermorelin | -20 C long term (-80 C acceptable), sealed and desiccated; 2-8 C for weeks | protect from light; contains Met/Cys/Trp: oxidation-prone; minimise air/headspace exposure (source) |
Typical analytical method: Sermorelin
Reference HPLC and MS conditions from the Sable analytical-methods file; a lot's CoA states the method actually used. See how to read a CoA.
| Compound | HPLC column / detection | MS / expected ion |
|---|---|---|
| Sermorelin | C18 reversed-phase (100-120 A pore); 214-220 nm (peptide bond) and 280 nm (Trp/Tyr present) | ESI-MS (positive mode); LC-MS for identity; [M+3H]3+ ~1120.3; [M+4H]4+ ~840.5; [M+5H]5+ ~672.6; [M+6H]6+ ~560.7 |
Research use only. Not a medicine. Not for human or veterinary use.