What is the amino acid sequence of LL-37?
LL-37 is a research peptide whose amino acid sequence is on the public registry record. The published sequence is [LL-37, 37 aa] Its molecular formula is C205H340N60O53. Its molecular weight is 4493.0 g/mol. The CAS Registry Number is 154947-66-7. PubChem CID 16198951 indexes the structure.
Sequence. [LL-37, 37 aa]
Class. peptide.
Formula. C205H340N60O53.
Mass. 4493.0 g/mol.
Analytical note. Identity confirmation by mass spectrometry uses the mass calculated from the formula. Sable's release specification is ≥99% by HPLC with identity confirmed against the expected mass (quality page). Research use only. Not a medicine. Not for human or veterinary use.
Sources
LL-37: reference facts
8 LL-37 values, each linked to its public source; see the LL-37 reference page.
| Synonyms | cathelicidin antimicrobial peptide; CAMP (134-170) (pubchem.ncbi.nlm.nih.gov) |
|---|---|
| Compound class | peptide (pubchem.ncbi.nlm.nih.gov) |
| CAS Registry Number | 154947-66-7 (pubchem.ncbi.nlm.nih.gov) |
| Sequence | [LL-37, 37 aa] (pubchem.ncbi.nlm.nih.gov) |
| Molecular formula | C205H340N60O53 (pubchem.ncbi.nlm.nih.gov) |
| Molecular weight | 4493.0 g/mol (pubchem.ncbi.nlm.nih.gov) |
| PubChem CID | 16198951 (pubchem.ncbi.nlm.nih.gov) |
| Storage (lyophilised) | -20 °C, dry, protected from light (sigmaaldrich.com) |
Calculated sequence properties
Computed from the listed sequence. See the methodology.
| Length | 37 residues |
|---|---|
| Theoretical pI | 11.35 (calculated from sequence) |
| Net charge at pH 7 | 5.98 (calculated) |
Sizes and prices at Sable
| Vial | Price | Per mg | UK same-size check (2026-10-16) |
|---|---|---|---|
| 5 mg | £19.93 | £3.99 | lowest other £19.95 across 8 UK sellers |
| 10 mg | £34.99 | £3.50 | no same-size match |
Multi-vial pricing on the same item: 3+ vials 10% off, 5+ vials 15% off, 10+ vials 20% off. Every lot has a certificate of analysis: CoA library.
Typical analytical method
| HPLC column | C18 reversed-phase (300 A pore, C4/C8 suitable for large/lipidated) |
|---|---|
| Mobile phase | A: water + 0.1% TFA; B: acetonitrile + 0.1% TFA; linear gradient (e.g. 5-65% B over 20-30 min) |
| Detection | 214-220 nm (peptide bond) |
General literature method. The lot CoA records the method actually used. How to read an HPLC chromatogram.
Related questions
Lyophilised storage on file: LL-37
From the Sable storage reference (lyophilised material only; temperature, light, moisture). Literature basis is linked per row. See peptide storage.
| Compound | Lyophilised storage | Light / notes |
|---|---|---|
| LL-37 | -20 C long term (-80 C acceptable), sealed and desiccated; 2-8 C for weeks | protect from light; no specific sequence liabilities identified from sequence data on file (source) |
Typical analytical method: LL-37
Reference HPLC and MS conditions from the Sable analytical-methods file; a lot's CoA states the method actually used. See how to read a CoA.
| Compound | HPLC column / detection | MS / expected ion |
|---|---|---|
| LL-37 | C18 reversed-phase (300 A pore, C4/C8 suitable for large/lipidated); 214-220 nm (peptide bond) | ESI-MS (positive mode); LC-MS for identity; [M+3H]3+ ~1498.7; [M+4H]4+ ~1124.3; [M+5H]5+ ~899.6; [M+6H]6+ ~749.8 |
Research use only. Not a medicine. Not for human or veterinary use.