--- title: "What is the amino acid sequence of tesamorelin?" description: "Tesamorelin is a research peptide whose amino acid sequence is on the public registry record." canonical: https://www.sablepeptides.co.uk/questions/tesamorelin-sequence publisher: Sable Peptides Limited (UK company 17488610) note: Research use only. Not for human or veterinary use. --- # What is the amino acid sequence of tesamorelin? Tesamorelin is a research peptide whose amino acid sequence is on the public registry record. The published sequence is YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (GHRH 1-44 backbone; N-terminal trans-3-hexenoyl group not shown). Its molecular formula is C221H366N72O67S. Its molecular weight is 5136.0 g/mol. The CAS Registry Number is 218949-48-5. Sequence. YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (GHRH 1-44 backbone; N-terminal trans-3-hexenoyl group not shown) Class. peptide. Formula. C221H366N72O67S. Mass. 5136.0 g/mol. Analytical note. Identity confirmation by mass spectrometry uses the mass calculated from the formula. Sable's release specification is ≥99% by HPLC with identity confirmed against the expected mass (quality page). Research use only. Not a medicine. Not for human or veterinary use. ## Sources - [https://pubchem.ncbi.nlm.nih.gov/rest/pug\_view/data/compound/16137828/JSON?heading=Biologic%20Line%20Notation](https://pubchem.ncbi.nlm.nih.gov/rest/pug_view/data/compound/16137828/JSON?heading=Biologic%20Line%20Notation) - [https://pubchem.ncbi.nlm.nih.gov/compound/16137828](https://pubchem.ncbi.nlm.nih.gov/compound/16137828) ## Tesamorelin: reference facts 7 Tesamorelin values, each linked to its public source; see the [Tesamorelin reference page](/ref/tesamorelin). | Synonyms | TH9507; trans-3-hexenoyl-GHRH(1-44)NH2 (pubchem.ncbi.nlm.nih.gov) | | --- | --- | | Compound class | peptide (pubchem.ncbi.nlm.nih.gov) | | CAS Registry Number | 218949-48-5 (pubchem.ncbi.nlm.nih.gov) | | Molecular formula | C221H366N72O67S (pubchem.ncbi.nlm.nih.gov) | | Molecular weight | 5136.0 g/mol (pubchem.ncbi.nlm.nih.gov) | | PubChem CID | 16137828 (pubchem.ncbi.nlm.nih.gov) | | Storage (lyophilised) | -20 °C, dry, protected from light (sigmaaldrich.com) | ## Sizes and prices at Sable | Vial | Price | Per mg | UK same-size check (2026-10-16) | | --- | --- | --- | --- | | 2 mg | £19.93 | £9.97 | lowest other £19.95 across 3 UK sellers | | 5 mg | £24.97 | £4.99 | lowest other £24.99 across 8 UK sellers | | 10 mg | £27.93 | £2.79 | lowest other £27.95 across 14 UK sellers | | 20 mg | £74.98 | £3.75 | lowest other £75.00 across 4 UK sellers | Multi-vial pricing on the same item: 3+ vials 10% off, 5+ vials 15% off, 10+ vials 20% off. Every lot has a certificate of analysis: [CoA library](/coa). ## Typical analytical method | HPLC column | C18 reversed-phase (300 A pore, C4/C8 suitable for large/lipidated) | | --- | --- | | Mobile phase | A: water + 0.1% TFA; B: acetonitrile + 0.1% TFA; linear gradient (e.g. 5-65% B over 20-30 min) | | Detection | 214-220 nm (peptide bond) and 280 nm (Trp/Tyr present) | General literature method. The lot CoA records the method actually used. [How to read an HPLC chromatogram](/learn/how-to-read-an-hplc-chromatogram). ## Related questions - [What is the molecular formula of tesamorelin?](/questions/tesamorelin-molecular-formula) - [What is the molecular weight of tesamorelin?](/questions/tesamorelin-molecular-weight) - [What does Tesamorelin dissolve in?](/questions/tesamorelin-solubility) - [How stable is lyophilised Tesamorelin?](/questions/tesamorelin-stability-lyophilised) ## Lyophilised storage on file From the Sable storage reference (lyophilised material only; temperature, light, moisture). Literature basis is linked per row. See [peptide storage](/learn/peptide-storage-and-solubility). | Compound | Lyophilised storage | Light / notes | | --- | --- | --- | | Tesamorelin | -20 C long term (-80 C acceptable), sealed and desiccated; 2-8 C for weeks | protect from light; contains Met/Cys/Trp: oxidation-prone; minimise air/headspace exposure (source) | | Tesamorelin + Ipamorelin | -20 C long term (-80 C acceptable), sealed and desiccated; 2-8 C for weeks | protect from light; multi-component: apply the most restrictive condition of the components (source) | ## Typical analytical method: Tesamorelin Reference HPLC and MS conditions from the Sable analytical-methods file; a lot's CoA states the method actually used. See [how to read a CoA](/guides/how-to-read-a-coa). | Compound | HPLC column / detection | MS / expected ion | | --- | --- | --- | | Tesamorelin | C18 reversed-phase (300 A pore, C4/C8 suitable for large/lipidated); 214-220 nm (peptide bond) and 280 nm (Trp/Tyr present) | ESI-MS (positive mode); LC-MS for identity; [M+3H]3+ ~1713.0; [M+4H]4+ ~1285.0; [M+5H]5+ ~1028.2; [M+6H]6+ ~857.0 | Research use only. Not a medicine. Not for human or veterinary use.