---
title: "What is the amino acid sequence of sermorelin?"
description: "Sermorelin is a research peptide whose amino acid sequence is on the public registry record. The published sequence is YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2."
canonical: https://www.sablepeptides.co.uk/questions/sermorelin-sequence
publisher: Sable Peptides Limited (UK company 17488610)
note: Research use only. Not for human or veterinary use.
---

# What is the amino acid sequence of sermorelin?

Sermorelin is a research peptide whose amino acid sequence is on the public registry record. The published sequence is YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2. Its molecular formula is C149H246N44O42S. Its molecular weight is 3357.9 g/mol. The CAS Registry Number is 86168-78-7. PubChem CID 16132413 indexes the structure.

Sequence. YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2

Class. peptide.

Formula. C149H246N44O42S.

Mass. 3357.9 g/mol.

Analytical note. Identity confirmation by mass spectrometry uses the mass calculated from the formula. Sable's release specification is ≥99% by HPLC with identity confirmed against the expected mass (quality page). Research use only. Not a medicine. Not for human or veterinary use.

## Sources

-   [https://pubchem.ncbi.nlm.nih.gov/compound/16132413](https://pubchem.ncbi.nlm.nih.gov/compound/16132413)

## Sermorelin: reference facts

8 Sermorelin values, each linked to its public source; see the [Sermorelin reference page](/ref/sermorelin).

| Synonyms | GRF(1-29)NH2; GHRH (1-29) (pubchem.ncbi.nlm.nih.gov) |
| --- | --- |
| Compound class | peptide (pubchem.ncbi.nlm.nih.gov) |
| CAS Registry Number | 86168-78-7 (pubchem.ncbi.nlm.nih.gov) |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (pubchem.ncbi.nlm.nih.gov) |
| Molecular formula | C149H246N44O42S (pubchem.ncbi.nlm.nih.gov) |
| Molecular weight | 3357.9 g/mol (pubchem.ncbi.nlm.nih.gov) |
| PubChem CID | 16132413 (pubchem.ncbi.nlm.nih.gov) |
| Storage (lyophilised) | -20 °C, dry, protected from light (sigmaaldrich.com) |

## Calculated sequence properties

Computed from the listed sequence. See the [methodology](/data/methodology).

| Length | 29 residues |
| --- | --- |
| Theoretical pI | 10.95 (calculated from sequence) |
| Net charge at pH 7 | 3.98 (calculated) |
| Extinction coefficient, 280 nm | 2980 M⁻¹cm⁻¹ (calculated) |

## Sizes and prices at Sable

| Vial | Price | Per mg | UK same-size check (2026-10-16) |
| --- | --- | --- | --- |
| 2 mg | £12.93 | £6.47 | lowest other £13.95 across 2 UK sellers |
| 5 mg | £22.48 | £4.50 | lowest other £22.50 across 4 UK sellers |
| 10 mg | £30.49 | £3.05 | lowest other £64.99 across 1 UK sellers |

Multi-vial pricing on the same item: 3+ vials 10% off, 5+ vials 15% off, 10+ vials 20% off. Every lot has a certificate of analysis: [CoA library](/coa).

## Typical analytical method

| HPLC column | C18 reversed-phase (100-120 A pore) |
| --- | --- |
| Mobile phase | A: water + 0.1% TFA; B: acetonitrile + 0.1% TFA; linear gradient (e.g. 5-65% B over 20-30 min) |
| Detection | 214-220 nm (peptide bond) and 280 nm (Trp/Tyr present) |

General literature method. The lot CoA records the method actually used. [How to read an HPLC chromatogram](/learn/how-to-read-an-hplc-chromatogram).

## Related questions

-   [What does Sermorelin dissolve in?](/questions/sermorelin-solubility)
-   [How stable is lyophilised Sermorelin?](/questions/sermorelin-stability-lyophilised)

## Lyophilised storage on file: Sermorelin

From the Sable storage reference (lyophilised material only; temperature, light, moisture). Literature basis is linked per row. See [peptide storage](/learn/peptide-storage-and-solubility).

| Compound | Lyophilised storage | Light / notes |
| --- | --- | --- |
| Sermorelin | -20 C long term (-80 C acceptable), sealed and desiccated; 2-8 C for weeks | protect from light; contains Met/Cys/Trp: oxidation-prone; minimise air/headspace exposure (source) |

## Typical analytical method: Sermorelin

Reference HPLC and MS conditions from the Sable analytical-methods file; a lot's CoA states the method actually used. See [how to read a CoA](/guides/how-to-read-a-coa).

| Compound | HPLC column / detection | MS / expected ion |
| --- | --- | --- |
| Sermorelin | C18 reversed-phase (100-120 A pore); 214-220 nm (peptide bond) and 280 nm (Trp/Tyr present) | ESI-MS (positive mode); LC-MS for identity; [M+3H]3+ ~1120.3; [M+4H]4+ ~840.5; [M+5H]5+ ~672.6; [M+6H]6+ ~560.7 |

Research use only. Not a medicine. Not for human or veterinary use.