---
title: "What is the molecular formula of LL-37? | Sable Peptides"
description: "LL-37 has the molecular formula C205H340N60O53. The corresponding molecular weight is 4493.0 g/mol. CAS Registry Number 154947-66-7. PubChem CID 16198951."
canonical: https://www.sablepeptides.co.uk/questions/ll-37-molecular-formula
publisher: Sable Peptides Limited (UK company 17488610)
note: Research use only. Not for human or veterinary use.
---

# What is the molecular formula of LL-37?

LL-37 has the molecular formula C205H340N60O53. The corresponding molecular weight is 4493.0 g/mol. CAS Registry Number 154947-66-7. PubChem CID 16198951. Synonyms include cathelicidin antimicrobial peptide; CAMP (134-170). The expected mass for identity confirmation by mass spectrometry is derived from this formula.

Formula. C205H340N60O53.

Sequence. [LL-37, 37 aa]

Analytical note. The expected mass for identity confirmation by mass spectrometry is derived from this formula. Sable's release specification is ≥99% by HPLC with identity confirmed against the expected mass (quality page). Research use only. Not a medicine. Not for human or veterinary use.

## Sources

-   [https://pubchem.ncbi.nlm.nih.gov/compound/16198951](https://pubchem.ncbi.nlm.nih.gov/compound/16198951)

## LL-37: reference facts

8 LL-37 values, each linked to its public source; see the [LL-37 reference page](/ref/ll-37).

| Synonyms | cathelicidin antimicrobial peptide; CAMP (134-170) (pubchem.ncbi.nlm.nih.gov) |
| --- | --- |
| Compound class | peptide (pubchem.ncbi.nlm.nih.gov) |
| CAS Registry Number | 154947-66-7 (pubchem.ncbi.nlm.nih.gov) |
| Sequence | [LL-37, 37 aa] (pubchem.ncbi.nlm.nih.gov) |
| Molecular formula | C205H340N60O53 (pubchem.ncbi.nlm.nih.gov) |
| Molecular weight | 4493.0 g/mol (pubchem.ncbi.nlm.nih.gov) |
| PubChem CID | 16198951 (pubchem.ncbi.nlm.nih.gov) |
| Storage (lyophilised) | -20 °C, dry, protected from light (sigmaaldrich.com) |

## Calculated sequence properties

Computed from the listed sequence. See the [methodology](/data/methodology).

| Length | 37 residues |
| --- | --- |
| Theoretical pI | 11.35 (calculated from sequence) |
| Net charge at pH 7 | 5.98 (calculated) |

## Sizes and prices at Sable

| Vial | Price | Per mg | UK same-size check (2026-10-16) |
| --- | --- | --- | --- |
| 5 mg | £19.93 | £3.99 | lowest other £19.95 across 8 UK sellers |
| 10 mg | £34.99 | £3.50 | no same-size match |

Multi-vial pricing on the same item: 3+ vials 10% off, 5+ vials 15% off, 10+ vials 20% off. Every lot has a certificate of analysis: [CoA library](/coa).

## Typical analytical method

| HPLC column | C18 reversed-phase (300 A pore, C4/C8 suitable for large/lipidated) |
| --- | --- |
| Mobile phase | A: water + 0.1% TFA; B: acetonitrile + 0.1% TFA; linear gradient (e.g. 5-65% B over 20-30 min) |
| Detection | 214-220 nm (peptide bond) |

General literature method. The lot CoA records the method actually used. [How to read an HPLC chromatogram](/learn/how-to-read-an-hplc-chromatogram).

## Related questions

-   [What is the molecular weight of LL-37?](/questions/ll-37-molecular-weight)
-   [What is the amino acid sequence of LL-37?](/questions/ll-37-sequence)
-   [What does LL-37 dissolve in?](/questions/ll-37-solubility)
-   [How stable is lyophilised LL-37?](/questions/ll-37-stability-lyophilised)

## Lyophilised storage on file: LL-37

From the Sable storage reference (lyophilised material only; temperature, light, moisture). Literature basis is linked per row. See [peptide storage](/learn/peptide-storage-and-solubility).

| Compound | Lyophilised storage | Light / notes |
| --- | --- | --- |
| LL-37 | -20 C long term (-80 C acceptable), sealed and desiccated; 2-8 C for weeks | protect from light; no specific sequence liabilities identified from sequence data on file (source) |

## Typical analytical method: LL-37

Reference HPLC and MS conditions from the Sable analytical-methods file; a lot's CoA states the method actually used. See [how to read a CoA](/guides/how-to-read-a-coa).

| Compound | HPLC column / detection | MS / expected ion |
| --- | --- | --- |
| LL-37 | C18 reversed-phase (300 A pore, C4/C8 suitable for large/lipidated); 214-220 nm (peptide bond) | ESI-MS (positive mode); LC-MS for identity; [M+3H]3+ ~1498.7; [M+4H]4+ ~1124.3; [M+5H]5+ ~899.6; [M+6H]6+ ~749.8 |

Research use only. Not a medicine. Not for human or veterinary use.