---
title: "What is the amino acid sequence of FOXO4-DRI? | Sable Peptides"
description: "FOXO4-DRI is a research peptide whose amino acid sequence is on the public registry record."
canonical: https://www.sablepeptides.co.uk/questions/foxo4-dri-sequence
publisher: Sable Peptides Limited (UK company 17488610)
note: Research use only. Not for human or veterinary use.
---

# What is the amino acid sequence of FOXO4-DRI?

FOXO4-DRI is a research peptide whose amino acid sequence is on the public registry record. The published sequence is LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (all D-amino acids except Gly). Its molecular formula is C228H388N86O64. Its molecular weight is 5358.0 g/mol. The CAS Registry Number is 2460055-10-9.

Sequence. LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (all D-amino acids except Gly)

Class. peptide (D-retro-inverso).

Formula. C228H388N86O64.

Mass. 5358.0 g/mol.

Analytical note. Identity confirmation by mass spectrometry uses the mass calculated from the formula. Sable's release specification is ≥99% by HPLC with identity confirmed against the expected mass (quality page). Research use only. Not a medicine. Not for human or veterinary use.

## Sources

-   [https://pubchem.ncbi.nlm.nih.gov/rest/pug\_view/data/compound/167312269/JSON?heading=Biologic%20Line%20Notation](https://pubchem.ncbi.nlm.nih.gov/rest/pug_view/data/compound/167312269/JSON?heading=Biologic%20Line%20Notation)
-   [https://pubchem.ncbi.nlm.nih.gov/compound/167312269](https://pubchem.ncbi.nlm.nih.gov/compound/167312269)

## FOXO4-DRI: reference facts

7 FOXO4-DRI values, each linked to its public source; see the [FOXO4-DRI reference page](/ref/foxo4-dri).

| Synonyms | FOXO4 D-retro-inverso peptide (pubchem.ncbi.nlm.nih.gov) |
| --- | --- |
| Compound class | peptide (D-retro-inverso) (pubchem.ncbi.nlm.nih.gov) |
| CAS Registry Number | 2460055-10-9 (pubchem.ncbi.nlm.nih.gov) |
| Molecular formula | C228H388N86O64 (pubchem.ncbi.nlm.nih.gov) |
| Molecular weight | 5358.0 g/mol (pubchem.ncbi.nlm.nih.gov) |
| PubChem CID | 167312269 (pubchem.ncbi.nlm.nih.gov) |
| Storage (lyophilised) | -20 °C, dry, protected from light (sigmaaldrich.com) |

## Calculated sequence properties

Computed from the listed sequence. See the [methodology](/data/methodology).

| Length | 46 residues |
| --- | --- |
| Theoretical pI | 12.51 (calculated from sequence) |
| Net charge at pH 7 | 10.98 (calculated) |
| Extinction coefficient, 280 nm | 6990 M⁻¹cm⁻¹ (calculated) |
| Structure note | all D-amino acids except Gly |

## Sizes and prices at Sable

| Vial | Price | Per mg | UK same-size check (2026-10-16) |
| --- | --- | --- | --- |
| 5 mg | £79.99 | £16.00 | no same-size match |
| 10 mg | £49.98 | £5.00 | lowest other £50.00 across 2 UK sellers |

Multi-vial pricing on the same item: 3+ vials 10% off, 5+ vials 15% off, 10+ vials 20% off. Every lot has a certificate of analysis: [CoA library](/coa).

## Typical analytical method

| HPLC column | C18 reversed-phase (300 A pore, C4/C8 suitable for large/lipidated) |
| --- | --- |
| Mobile phase | A: water + 0.1% TFA; B: acetonitrile + 0.1% TFA; linear gradient (e.g. 5-65% B over 20-30 min) |
| Detection | 214-220 nm (peptide bond) and 280 nm (Trp/Tyr present) |

General literature method. The lot CoA records the method actually used. [How to read an HPLC chromatogram](/learn/how-to-read-an-hplc-chromatogram).

## Related questions

-   [What is the molecular weight of FOXO4-DRI?](/questions/foxo4-dri-molecular-weight)

## Lyophilised storage on file: FOXO4-DRI

From the Sable storage reference (lyophilised material only; temperature, light, moisture). Literature basis is linked per row. See [peptide storage](/learn/peptide-storage-and-solubility).

| Compound | Lyophilised storage | Light / notes |
| --- | --- | --- |
| FOXO4-DRI | -20 C long term (-80 C acceptable), sealed and desiccated; 2-8 C for weeks | protect from light; contains Met/Cys/Trp: oxidation-prone; minimise air/headspace exposure; Asn-Gly motif: deamidation-prone in solution (source) |

## Typical analytical method: FOXO4-DRI

Reference HPLC and MS conditions from the Sable analytical-methods file; a lot's CoA states the method actually used. See [how to read a CoA](/guides/how-to-read-a-coa).

| Compound | HPLC column / detection | MS / expected ion |
| --- | --- | --- |
| FOXO4-DRI | C18 reversed-phase (300 A pore, C4/C8 suitable for large/lipidated); 214-220 nm (peptide bond) and 280 nm (Trp/Tyr present) | ESI-MS (positive mode); LC-MS for identity; [M+3H]3+ ~1787.0; [M+4H]4+ ~1340.5; [M+5H]5+ ~1072.6; [M+6H]6+ ~894.0 |

Research use only. Not a medicine. Not for human or veterinary use.