---
title: "What is the amino acid sequence of cagrilintide?"
description: "Cagrilintide is a research peptide whose amino acid sequence is on the public registry record."
canonical: https://www.sablepeptides.co.uk/questions/cagrilintide-sequence
publisher: Sable Peptides Limited (UK company 17488610)
note: Research use only. Not for human or veterinary use.
---

# What is the amino acid sequence of cagrilintide?

Cagrilintide is a research peptide whose amino acid sequence is on the public registry record. The published sequence is XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP (PubChem line notation; X = non-standard N-terminal unit). Its molecular formula is C194H312N54O59S2. Its molecular weight is 4409.0 g/mol. The CAS Registry Number is 1415456-99-3.

Sequence. XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP (PubChem line notation; X = non-standard N-terminal unit)

Class. peptide (lipidated).

Formula. C194H312N54O59S2.

Mass. 4409.0 g/mol.

Analytical note. Identity confirmation by mass spectrometry uses the mass calculated from the formula. Sable's release specification is ≥99% by HPLC with identity confirmed against the expected mass (quality page). Research use only. Not a medicine. Not for human or veterinary use.

## Sources

-   [https://pubchem.ncbi.nlm.nih.gov/rest/pug\_view/data/compound/171397054/JSON?heading=Biologic%20Line%20Notation](https://pubchem.ncbi.nlm.nih.gov/rest/pug_view/data/compound/171397054/JSON?heading=Biologic%20Line%20Notation)
-   [https://pubchem.ncbi.nlm.nih.gov/compound/171397054](https://pubchem.ncbi.nlm.nih.gov/compound/171397054)

## Cagrilintide: reference facts

7 Cagrilintide values, each linked to its public source; see the [Cagrilintide reference page](/ref/cagrilintide).

| Synonyms | long-acting acylated amylin analogue (pubchem.ncbi.nlm.nih.gov) |
| --- | --- |
| Compound class | peptide (lipidated) (pubchem.ncbi.nlm.nih.gov) |
| CAS Registry Number | 1415456-99-3 (pubchem.ncbi.nlm.nih.gov) |
| Molecular formula | C194H312N54O59S2 (pubchem.ncbi.nlm.nih.gov) |
| Molecular weight | 4409.0 g/mol (pubchem.ncbi.nlm.nih.gov) |
| PubChem CID | 171397054 (pubchem.ncbi.nlm.nih.gov) |
| Storage (lyophilised) | -20 °C, dry, protected from light (sigmaaldrich.com) |

## Sizes and prices at Sable

| Vial | Price | Per mg | UK same-size check (2026-10-16) |
| --- | --- | --- | --- |
| 2 mg | £25.99 | £13.00 | no same-size match |
| 5 mg | £28.98 | £5.80 | lowest other £29.00 across 1 UK sellers |
| 10 mg | £43.99 | £4.40 | lowest other £65.00 across 2 UK sellers |

Multi-vial pricing on the same item: 3+ vials 10% off, 5+ vials 15% off, 10+ vials 20% off. Every lot has a certificate of analysis: [CoA library](/coa).

## Typical analytical method

| HPLC column | C18 reversed-phase (300 A pore, C4/C8 suitable for large/lipidated) |
| --- | --- |
| Mobile phase | A: water + 0.1% TFA; B: acetonitrile + 0.1% TFA; linear gradient (e.g. 5-65% B over 20-30 min) |
| Detection | 214-220 nm (peptide bond) |

General literature method. The lot CoA records the method actually used. [How to read an HPLC chromatogram](/learn/how-to-read-an-hplc-chromatogram).

## Related questions

-   [What is the molecular weight of cagrilintide?](/questions/cagrilintide-molecular-weight)
-   [What does Cagrilintide dissolve in?](/questions/cagrilintide-solubility)
-   [How stable is lyophilised Cagrilintide?](/questions/cagrilintide-stability-lyophilised)

## Lyophilised storage on file: Cagrilintide

From the Sable storage reference (lyophilised material only; temperature, light, moisture). Literature basis is linked per row. See [peptide storage](/learn/peptide-storage-and-solubility).

| Compound | Lyophilised storage | Light / notes |
| --- | --- | --- |
| Cagrilintide | -20 C long term (-80 C acceptable), sealed and desiccated; 2-8 C for weeks | protect from light; contains Met/Cys/Trp: oxidation-prone; minimise air/headspace exposure (source) |

## Typical analytical method: Cagrilintide

Reference HPLC and MS conditions from the Sable analytical-methods file; a lot's CoA states the method actually used. See [how to read a CoA](/guides/how-to-read-a-coa).

| Compound | HPLC column / detection | MS / expected ion |
| --- | --- | --- |
| Cagrilintide | C18 reversed-phase (300 A pore, C4/C8 suitable for large/lipidated); 214-220 nm (peptide bond) | ESI-MS (positive mode); LC-MS for identity; [M+3H]3+ ~1470.7; [M+4H]4+ ~1103.3; [M+5H]5+ ~882.8; [M+6H]6+ ~735.8 |

Research use only. Not a medicine. Not for human or veterinary use.